Recombinant Xanthomonas campestris pv. translucens Ice nucleation protein (inaX), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC28345
Article Name: Recombinant Xanthomonas campestris pv. translucens Ice nucleation protein (inaX), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC28345
Supplier Catalog Number: RPC28345
Alternative Catalog Number: BIM-RPC28345-20UG,BIM-RPC28345-100UG,BIM-RPC28345-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Recombinant Xanthomonas campestris pv. translucens Ice nucleation protein (inaX), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Xanthomonas campestris pv. translucens. Target Name: inaX. Accession Number: P18127. Expression Region: 1412~1567aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 22.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 22.3kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: AGDRSKLIAGADSTQTAGDRSKLLAGRNSYLTAGDRSKLTAGDDSTLMAGDRSKLTAGKNSVLTAGANSRLIGSLGSTLSGGENSTLIFRCWDGERYTNLVVRTGEQGVESDIPYQVDDEGNLVGKADDDLVLDYDPGMILDGQCSPGTGEELRDV
Target: inaX