Recombinant Human Interleukin-15 (IL15) , Active Protein, Unconjugated, E. coli

Catalog Number: BIM-RPC29192
Article Name: Recombinant Human Interleukin-15 (IL15) , Active Protein, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC29192
Supplier Catalog Number: RPC29192
Alternative Catalog Number: BIM-RPC29192-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Interleukin-15, IL-15, IL15
Accession Number: P40933; IL15. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 49-162aa. Protein Length: Full Length of Mature Protein. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Immunology. Shipping Condition: Ice packs. Short Description: Recombinant Human Interleukin-15 (IL15) , Active Protein is a purified Active Recombinant Protein
Molecular Weight: 12.5kDa
Tag: Tag-Free
Purity: >95% by SDS-PAGE
Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Target: Interleukin-15 (IL15)