Recombinant Streptococcus pyogenes DNA-binding protein HU (hup), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Streptococcus pyogenes DNA-binding protein HU (hup), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29598
• Supplier Catalog Number: RPC29598
• Alternative Catalog Number: BIM-RPC29598-20UG,BIM-RPC29598-100UG,BIM-RPC29598-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Bacteria
• Conjugation: Unconjugated

Product Description

Recombinant Streptococcus pyogenes DNA-binding protein HU (hup) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Streptococcus pyogenes. Target Name: DNA-binding protein HU (hup) . Accession Number: P0C0H2, hup. Expression Region: 1-91aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 17.1kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 17.1kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: MANKQDLIAKVAEATELTKKDSAAAVDAVFSTIEAFLAEGEKVQLIGFGNFEVRERAARKGRNPQTGAEIEIAASKVPAFKAGKALKDAVK
• Target: DNA-binding protein HU (hup)