Recombinant Ixodes scapularis Tick receptor for ospA (TROSPA), Unconjugated, Virus

Catalog Number: BIM-RPC29767
Article Name: Recombinant Ixodes scapularis Tick receptor for ospA (TROSPA), Unconjugated, Virus
Biozol Catalog Number: BIM-RPC29767
Supplier Catalog Number: RPC29767
Alternative Catalog Number: BIM-RPC29767-20UG,BIM-RPC29767-100UG,BIM-RPC29767-1MG
Manufacturer: Biomatik Corporation
Host: Virus
Category: Proteine/Peptide
Conjugation: Unconjugated
Accession Number: Q5SDL7; TROSPA. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-161aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Ixodes scapularis Tick receptor for ospA (TROSPA) is a purified Recombinant Protein
Molecular Weight: 21.7kDa
Tag: C-Terminal 6xHis-Tagged
Purity: >85% by SDS-PAGE
Sequence: MVAMEAMAAMEVMVAAMAATADTVASSAASATATEATVAMDTASLSLPLQLSPRSLPQSSLSATAATVATDTVVSSADTEVSDTEDSAATVSATASLSMLPQSSPRSLPQSSLSATAATVDSVTDMADTAMDTKQFISKGNEHFFAASYLCAWADQSAAGS
Target: Tick receptor for ospA (TROSPA)