Recombinant Human DNA polymerase theta (POLQ), partial, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human DNA polymerase theta (POLQ), partial, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29770
• Supplier Catalog Number: RPC29770
• Alternative Catalog Number: BIM-RPC29770-20UG,BIM-RPC29770-100UG,BIM-RPC29770-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: DNA polymerase eta

Product Description

Accession Number: O75417; POLQ. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1792-2590aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Epigenetics, Nuclear Signaling. Shipping Condition: Ice packs. Short Description: Recombinant Human DNA polymerase theta (POLQ), partial is a purified Recombinant Protein

Product Properties

• Molecular Weight: 96.9kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >85% by SDS-PAGE
• Sequence: GFKDNSPISDTSFSLQLSQDGLQLTPASSSSESLSIIDVASDQNLFQTFIKEWRCKKRFSISLACEKIRSLTSSKTATIGSRFKQASSPQEIPIRDDGFPIKGCDDTLVVGLAVCWGGRDAYYFSLQKEQKHSEISASLVPPSLDPSLTLKDRMWYLQSCLRKESDKECSVVIYDFIQSYKILLLSCGISLEQSYEDPKVACWLLDPDSQEPTLHSIVTSFLPHELPLLEGMETSQGIQSLGLNAGSEHSGRYR
• Target: DNA polymerase theta (POLQ)