Recombinant Klebsiella pneumoniae Outer membrane protein assembly factor BamA (bamA), partial, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Klebsiella pneumoniae Outer membrane protein assembly factor BamA (bamA), partial, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29773
• Supplier Catalog Number: RPC29773
• Alternative Catalog Number: BIM-RPC29773-20UG,BIM-RPC29773-100UG,BIM-RPC29773-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Bacteria
• Conjugation: Unconjugated
• Alternative Names: bamA, yaeT, KPK_4543Outer membrane protein assembly factor BamA

Product Description

Accession Number: B5Y1J4; bamA. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 24-172aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Klebsiella pneumoniae Outer membrane protein assembly factor BamA (bamA), partial is a purified Recombinant Protein

Product Properties

• Molecular Weight: 33.3kDa
• Tag: N-Terminal 10XHis-B2M-Tagged and C-Terminal Myc-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: FVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDDDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEG
• Target: Outer membrane protein assembly factor BamA (bamA)