Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5), Unconjugated, Yeast

Product Overview

• Article Name: Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5), Unconjugated, Yeast
• Biozol Catalog Number: BIM-RPC29781
• Supplier Catalog Number: RPC29781
• Alternative Catalog Number: BIM-RPC29781-20UG,BIM-RPC29781-100UG,BIM-RPC29781-1MG
• Manufacturer: Biomatik Corporation
• Host: Yeast
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: G lambda-1, Germline immunoglobulin lambda 1

Product Description

Accession Number: B9A064; IGLL5. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 36-214aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Immunology. Shipping Condition: Ice packs. Short Description: Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5) is a purified Recombinant Protein

Product Properties

• Molecular Weight: 21.3kDa
• Tag: N-Terminal 6xHis-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: HGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
• Target: Immunoglobulin lambda-like polypeptide 5 (IGLL5)