Recombinant Mouse Thy-1 membrane glycoprotein (Thy1), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Mouse Thy-1 membrane glycoprotein (Thy1), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29785
• Supplier Catalog Number: RPC29785
• Alternative Catalog Number: BIM-RPC29785-20UG,BIM-RPC29785-100UG,BIM-RPC29785-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Conjugation: Unconjugated
• Alternative Names: Thy-1 antigen, CD_antigen: CD90

Product Description

Accession Number: P01831; Thy1. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 20-131aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Immunology. Shipping Condition: Ice packs. Short Description: Recombinant Mouse Thy-1 membrane glycoprotein (Thy1) is a purified Recombinant Protein

Product Properties

• Molecular Weight: 28.8kDa
• Tag: N-Terminal 6xHis-SUMO-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC
• Target: Thy-1 membrane glycoprotein (Thy1)