Recombinant Penaeus monodon Arginine kinase (AK), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Penaeus monodon Arginine kinase (AK), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29788
• Supplier Catalog Number: RPC29788
• Alternative Catalog Number: BIM-RPC29788-20UG,BIM-RPC29788-100UG,BIM-RPC29788-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Crustacean
• Conjugation: Unconjugated
• Alternative Names: Allergen: Pen m 2

Product Description

Accession Number: C7E3T4; AK. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 2-356aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Allergen. Shipping Condition: Ice packs. Short Description: Recombinant Penaeus monodon Arginine kinase (AK) is a purified Recombinant Protein

Product Properties

• Molecular Weight: 56kDa
• Tag: N-Terminal 6xHis-SUMO-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: ADAAVIEKLEAGFKKLEAATDCKSLLKKYLSKAVFDQLKEKKTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFSPLFDPIIEDYHVGFKQTDKHPNKDFGDVNTFVNVDPEGKYVISTRVRCGRSMEGYPFNPCLTEAQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEK
• Target: Arginine kinase (AK)