Recombinant Human AP-2 complex subunit sigma (AP2S1), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human AP-2 complex subunit sigma (AP2S1), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29801
• Supplier Catalog Number: RPC29801
• Alternative Catalog Number: BIM-RPC29801-20UG,BIM-RPC29801-100UG,BIM-RPC29801-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Adaptor protein complex AP-2 subunit sigma, Adaptor-related protein complex 2 subunit sigma, Clathrin assembly protein 2 sigma small chain, Clathrin coat assembly protein AP17, Clathrin coat-associated protein AP17, HA2 17 kDa subunit, Plasma membrane ad

Product Description

Accession Number: P53680; AP2S1. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-142aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Signal Transduction. Shipping Condition: Ice packs. Short Description: Recombinant Human AP-2 complex subunit sigma (AP2S1) is a purified Recombinant Protein

Product Properties

• Molecular Weight: 23.9kDa
• Tag: C-Terminal 6xHis-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
• Target: AP-2 complex subunit sigma (AP2S1)