Recombinant Serratia marcescens Metallo-beta-lactamase type 2, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Serratia marcescens Metallo-beta-lactamase type 2, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29907
• Supplier Catalog Number: RPC29907
• Alternative Catalog Number: BIM-RPC29907-20UG,BIM-RPC29907-100UG,BIM-RPC29907-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Bacteria
• Conjugation: Unconjugated
• Alternative Names: B2 metallo-beta-lactamase BLA-IMP Beta-lactamase type II Metallo-beta-lactamase type II

Product Description

Recombinant Serratia marcescens Metallo-beta-lactamase type 2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Serratia marcescens. Target Name: Metallo-beta-lactamase type 2. Accession Number: P52699, N/A. Expression Region: 19-246aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 32.6kda. Target Synonyms: B2 metallo-beta-lactamase BLA-IMP Beta-lactamase type II Metallo-beta-lactamase type II Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 32.6kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: AESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSN
• Target: Metallo-beta-lactamase type 2