Recombinant Vesicular stomatitis Indiana virus Matrix protein (M), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Vesicular stomatitis Indiana virus Matrix protein (M), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29925
• Supplier Catalog Number: RPC29925
• Alternative Catalog Number: BIM-RPC29925-20UG,BIM-RPC29925-100UG,BIM-RPC29925-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Virus
• Conjugation: Unconjugated
• Alternative Names: M, Matrix protein

Product Description

Recombinant Vesicular stomatitis Indiana virus Matrix protein (M) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Vesicular stomatitis Indiana virus (strain 98COE North America) (VSIV). Target Name: Matrix protein (M) . Accession Number: Q8B0I2, M. Expression Region: 1-229aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 33.5kda. Target Synonyms: M, Matrix protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 33.5kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >85% by SDS-PAGE
• Sequence: MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKFFFTVKLTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEKKASGAWILDSVSHFK
• Target: Matrix protein (M)