Recombinant Human Signal peptide, CUB and EGF-like domain-containing protein 3 (SCUBE3), partial, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human Signal peptide, CUB and EGF-like domain-containing protein 3 (SCUBE3), partial, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29926
• Supplier Catalog Number: RPC29926
• Alternative Catalog Number: BIM-RPC29926-20UG,BIM-RPC29926-100UG,BIM-RPC29926-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated

Product Description

Recombinant Human Signal peptide, CUB and EGF-like domain-containing protein 3 (SCUBE3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Signal peptide, CUB and EGF-like domain-containing protein 3 (SCUBE3) . Accession Number: Q8IX30, SCUBE3. Expression Region: 804-916aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 20.2kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 20.2kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: CGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKRKILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQIPYVTY
• Target: Signal peptide, CUB and EGF-like domain-containing protein 3 (SCUBE3)