Recombinant Human UBA-like domain-containing protein 2 (UBALD2), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human UBA-like domain-containing protein 2 (UBALD2), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29927
• Supplier Catalog Number: RPC29927
• Alternative Catalog Number: BIM-RPC29927-20UG,BIM-RPC29927-100UG,BIM-RPC29927-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated

Product Description

Recombinant Human UBA-like domain-containing protein 2 (UBALD2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: UBA-like domain-containing protein 2 (UBALD2) . Accession Number: Q8IYN6, UBALD2. Expression Region: 2-164aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 25.2kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 25.2kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: SVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQMMCTPSNTPATPPNFPDALAMFSKLRASEGLQSSNSPMTAAACSPPANFSPFWASSPPSHQAPWIPPSSPTTFHHLHRPQPTWPPGAQQGGAQQKAMAAMDGQR
• Target: UBA-like domain-containing protein 2 (UBALD2)