Recombinant Human Serine/arginine repetitive matrix protein 2 (SRRM2), partial, Unconjugated, Virus

Catalog Number: BIM-RPC29942
Article Name: Recombinant Human Serine/arginine repetitive matrix protein 2 (SRRM2), partial, Unconjugated, Virus
Biozol Catalog Number: BIM-RPC29942
Supplier Catalog Number: RPC29942
Alternative Catalog Number: BIM-RPC29942-20UG,BIM-RPC29942-100UG,BIM-RPC29942-1MG
Manufacturer: Biomatik Corporation
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: 300 kDa nuclear matrix antigen, Serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa, SR-related nuclear matrix protein of 300 kDa, Ser/Arg-related nuclear matrix protein of 300 kDa, Splicing coactivator subunit SRm300, Tax-responsive enhancer element-binding protein 803, TaxREB803, KIAA0324, SRL300, SRM300
Recombinant Human Serine/arginine repetitive matrix protein 2 (SRRM2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Serine/arginine repetitive matrix protein 2 (SRRM2) . Accession Number: Q9UQ35, SRRM2. Expression Region: 1666-2089aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 53.8kda. Target Synonyms: 300 kDa nuclear matrix antigen, Serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa, SR-related nuclear matrix protein of 300 kDa, Ser/Arg-related nuclear matrix protein of 300 kDa, Splicing coactivator subunit SRm300, Tax-responsive enhancer element-binding protein 803, TaxREB803, KIAA0324, SRL300, SRM300 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 53.8kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >85% by SDS-PAGE
Sequence: RTARRGSRSSPEPKTKSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTSSRRRRGRSRTPPTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVTRRRSRSRASPVSR
Target: Serine/arginine repetitive matrix protein 2 (SRRM2)