Recombinant Human Polyadenylate-binding protein-interacting protein 1 (PAIP1), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human Polyadenylate-binding protein-interacting protein 1 (PAIP1), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29946
• Supplier Catalog Number: RPC29946
• Alternative Catalog Number: BIM-RPC29946-20UG,BIM-RPC29946-100UG,BIM-RPC29946-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Polyadenylate-binding protein-interacting protein 1, PABP-interacting protein 1, PAIP-1, Poly(A) -binding protein-interacting protein 1

Product Description

Recombinant Human Polyadenylate-binding protein-interacting protein 1 (PAIP1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Polyadenylate-binding protein-interacting protein 1 (PAIP1) . Accession Number: Q9H074, PAIP1. Expression Region: 1-479aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 61.0kda. Target Synonyms: Polyadenylate-binding protein-interacting protein 1, PABP-interacting protein 1, PAIP-1, Poly(A) -binding protein-interacting protein 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 61.0kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >85% by SDS-PAGE
• Sequence: MSDGFDRAPGAGRGRSRGLGRGGGGPEGGGFPNGAGPAERARHQPPQPKAPGFLQPPPLRQPRTTPPPGAQCEVPASPQRPSRPGALPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLSVNAPEFYPSGYSSSYTESYEDGCEDYPTLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEVKDQ
• Target: Polyadenylate-binding protein-interacting protein 1 (PAIP1)