Recombinant Human DNA polymerase theta (POLQ), partial, Unconjugated, Virus

Product Overview

• Article Name: Recombinant Human DNA polymerase theta (POLQ), partial, Unconjugated, Virus
• Biozol Catalog Number: BIM-RPC29947
• Supplier Catalog Number: RPC29947
• Alternative Catalog Number: BIM-RPC29947-20UG,BIM-RPC29947-100UG,BIM-RPC29947-1MG
• Manufacturer: Biomatik Corporation
• Host: Virus
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: DNA polymerase eta

Product Description

Recombinant Human DNA polymerase theta (POLQ), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: DNA polymerase theta (POLQ) . Accession Number: O75417, POLQ. Expression Region: 1820-2590aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Flag-tagged. Theoretical MW: 90.2kda. Target Synonyms: DNA polymerase eta Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 90.2kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Flag-Tagged
• Purity: >85% by SDS-PAGE
• Sequence: SSSESLSIIDVASDQNLFQTFIKEWRCKKRFSISLACEKIRSLTSSKTATIGSRFKQASSPQEIPIRDDGFPIKGCDDTLVVGLAVCWGGRDAYYFSLQKEQKHSEISASLVPPSLDPSLTLKDRMWYLQSCLRKESDKECSVVIYDFIQSYKILLLSCGISLEQSYEDPKVACWLLDPDSQEPTLHSIVTSFLPHELPLLEGMETSQGIQSLGLNAGSEHSGRYRASVESILIFNSMNQLNSLLQKENLQDVFR
• Target: DNA polymerase theta (POLQ)