Recombinant Human C-C chemokine receptor type 6 (CCR6), partial, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human C-C chemokine receptor type 6 (CCR6), partial, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29957
• Supplier Catalog Number: RPC29957
• Alternative Catalog Number: BIM-RPC29957-20UG,BIM-RPC29957-100UG,BIM-RPC29957-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Chemokine receptor-like 3, CKR-L3, DRY6, G-protein coupled receptor 29, GPR-CY4, GPRCY4, LARC receptor

Product Description

Recombinant Human C-C chemokine receptor type 6 (CCR6), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Homo sapiens(Human). Target Name: C-C chemokine receptor type 6 (CCR6) . Accession Number: P51684, CCR6. Expression Region: 1-47aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 12.9kda. Target Synonyms: Chemokine receptor-like 3, CKR-L3, DRY6, G-protein coupled receptor 29, GPR-CY4, GPRCY4, LARC receptor Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 12.9kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >85% by SDS-PAGE
• Sequence: MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRL
• Target: C-C chemokine receptor type 6 (CCR6)