Recombinant Human Decapping and exoribonuclease protein (DXO), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human Decapping and exoribonuclease protein (DXO), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29986
• Supplier Catalog Number: RPC29986
• Alternative Catalog Number: BIM-RPC29986-20UG,BIM-RPC29986-100UG,BIM-RPC29986-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: DXO, 5-3 exoribonuclease DXO, Dom-3 homolog Z, NAD-capped RNA hydrolase DXO, DeNADding enzyme DXO

Product Description

Recombinant Human Decapping and exoribonuclease protein (DXO) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Decapping and exoribonuclease protein (DXO) . Accession Number: O77932, DXO. Expression Region: 1-396aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 51.8kda. Target Synonyms: DXO, 5-3 exoribonuclease DXO, Dom-3 homolog Z, NAD-capped RNA hydrolase DXO, DeNADding enzyme DXO Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 51.8kDa
• Tag: C-Terminal 6xHis-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: MDPRGTKRGAEKTEVAEPRNKLPRPAPSLPTDPALYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPTNGPGPNFDLRDGYPDRYQPRDEEVQERLDHLLCWLLEHRGRLEGGPGWLAEAIVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPNARAQRLARPPLLRELMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLGSHPLLFSGEVDCTDPQAPSTQPPTCYVELK
• Target: Decapping and exoribonuclease protein (DXO)