Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC30528
• Supplier Catalog Number: RPC30528
• Alternative Catalog Number: BIM-RPC30528-20UG,BIM-RPC30528-100UG,BIM-RPC30528-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Bacteria
• Conjugation: Unconjugated
• Alternative Names: 168 kDa surface-layer protein, Cell surface antigen 5, Sca5, Surface protein antigen, rOmp B, rOmpB, 120 kDa outer membrane protein OmpB, Surface protein antigen, p120

Product Description

Accession Number: Q9KKA3; ompB. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1335-1655aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial is a purified Recombinant Protein

Product Properties

• Molecular Weight: 43.8kDa
• Tag: C-Terminal 6xHis-Avi-Tagged
• Purity: >85% by SDS-PAGE
• Sequence: GALRYLGTPETAEMAGPEAGAIPAAVAAGDEAVDNVAYGIWAKPFYTDAHQSKKGGLAGYKAKTTGVVIGLDTLANDNLMIGAAIGITKTDIKHQDYKKGDKTDVNGFSFSLYGAQQLVKNFFAQGSAIFSLNQVKNKSQRYFFDANGNMSKQIAAGHYDNMTFGGNLTVGYDYNAMQGVLVTPMAGLSYLKSSDENYKETGTTVANKQVNSKFSDRTDLIVGAKVAGSTMNITDLAVYPEVHAFVVHKVTGRL
• Target: Outer membrane protein B (ompB)