Recombinant Human Angiopoietin-2 (ANGPT2) , Active Protein, Unconjugated, Mammal

Product Overview

• Article Name: Recombinant Human Angiopoietin-2 (ANGPT2) , Active Protein, Unconjugated, Mammal
• Biozol Catalog Number: BIM-RPC30541
• Supplier Catalog Number: RPC30541
• Alternative Catalog Number: BIM-RPC30541-20UG,BIM-RPC30541-100UG,BIM-RPC30541-1MG
• Manufacturer: Biomatik Corporation
• Host: Mammal
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: ANG-2

Product Description

Accession Number: O15123; ANGPT2. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 19-496aa. Protein Length: Full Length of Mature Protein. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cardiovascular. Shipping Condition: Ice packs. Short Description: Recombinant Human Angiopoietin-2 (ANGPT2) , Active Protein is a purified Active Recombinant Protein

Product Properties

• Molecular Weight: 56.3kDa
• Tag: C-Terminal 10xHis-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPT
• Target: Angiopoietin-2 (ANGPT2)