Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial , Active Protein, Unconjugated, Mammal

Catalog Number: BIM-RPC30547
Article Name: Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial , Active Protein, Unconjugated, Mammal
Biozol Catalog Number: BIM-RPC30547
Supplier Catalog Number: RPC30547
Alternative Catalog Number: BIM-RPC30547-20UG,BIM-RPC30547-100UG,BIM-RPC30547-1MG
Manufacturer: Biomatik Corporation
Host: Mammal
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Gastric inhibitory polypeptide receptor, GIP-R, Glucose-dependent insulinotropic polypeptide receptor, Gipr
Accession Number: Q0P543; Gipr. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 19-134aa. Protein Length: Partial. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Obesity. Shipping Condition: Ice packs. Short Description: Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial , Active Protein is a purified Active Recombinant Protein
Molecular Weight: 14.7kDa
Tag: C-Terminal 10xHis-Tagged
Purity: >95% by SDS-PAGE
Sequence: ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ
Target: Gastric inhibitory polypeptide receptor (Gipr)