Recombinant Human Glutathione peroxidase 3 (GPX3, U73C), Unconjugated, Mammal

Product Overview

• Article Name: Recombinant Human Glutathione peroxidase 3 (GPX3, U73C), Unconjugated, Mammal
• Biozol Catalog Number: BIM-RPC30549
• Supplier Catalog Number: RPC30549
• Alternative Catalog Number: BIM-RPC30549-20UG,BIM-RPC30549-100UG,BIM-RPC30549-1MG
• Manufacturer: Biomatik Corporation
• Host: Mammal
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: GPx-3, GSHPx-3, Extracellular glutathione peroxidase, Plasma glutathione peroxidase, GPx-P, GSHPx-P

Product Description

Accession Number: P22352; GPX3. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 21-226aa(U73C). Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Human Glutathione peroxidase 3 (GPX3; U73C) is a purified Recombinant Protein

Product Properties

• Molecular Weight: 49.5kDa
• Tag: N-Terminal hFc-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: QSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYCGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK
• Target: Glutathione peroxidase 3 (GPX3, U73C)