Recombinant Mouse Pro-neuropeptide Y (Npy), partial, Unconjugated, Yeast

Product Overview

• Article Name: Recombinant Mouse Pro-neuropeptide Y (Npy), partial, Unconjugated, Yeast
• Biozol Catalog Number: BIM-RPC30567
• Supplier Catalog Number: RPC30567
• Alternative Catalog Number: BIM-RPC30567-20UG,BIM-RPC30567-100UG,BIM-RPC30567-1MG
• Manufacturer: Biomatik Corporation
• Host: Yeast
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Conjugation: Unconjugated
• Alternative Names: Pro-neuropeptide Y

Product Description

Accession Number: P57774; Npy. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 29-64aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Neuroscience. Shipping Condition: Ice packs. Short Description: Recombinant Mouse Pro-neuropeptide Y (Npy), partial is a purified Recombinant Protein

Product Properties

• Molecular Weight: 30.9kDa
• Tag: N-Terminal hFc-Tagged
• Purity: >85% by SDS-PAGE
• Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
• Target: Pro-neuropeptide Y (Npy)