Recombinant Mouse Regenerating islet-derived protein 3-gamma (Reg3g), Unconjugated, Yeast

Catalog Number: BIM-RPC30570
Article Name: Recombinant Mouse Regenerating islet-derived protein 3-gamma (Reg3g), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC30570
Supplier Catalog Number: RPC30570
Alternative Catalog Number: BIM-RPC30570-20UG,BIM-RPC30570-100UG,BIM-RPC30570-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Pancreatitis-associated protein 3Regenerating islet-derived protein III-gamma, Reg III-gamma
Accession Number: O09049; Reg3g. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 27-174aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Mouse Regenerating islet-derived protein 3-gamma (Reg3g) is a purified Recombinant Protein
Molecular Weight: 18.3kDa
Tag: N-Terminal 6xHis-Tagged
Purity: >90% by SDS-PAGE
Sequence: EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA
Target: Regenerating islet-derived protein 3-gamma (Reg3g)