Recombinant Rat Superoxide dismutase [Cu-Zn] (Sod1), Unconjugated, Yeast

Catalog Number: BIM-RPC30572
Article Name: Recombinant Rat Superoxide dismutase [Cu-Zn] (Sod1), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC30572
Supplier Catalog Number: RPC30572
Alternative Catalog Number: BIM-RPC30572-20UG,BIM-RPC30572-100UG,BIM-RPC30572-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Accession Number: P07632; Sod1. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 2-154aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Rat Superoxide dismutase [Cu-Zn] (Sod1) is a purified Recombinant Protein
Molecular Weight: 17.3kDa
Tag: N-Terminal 6xHis-Tagged
Purity: >90% by SDS-PAGE
Sequence: AMKAVCVLKGDGPVQGVIHFEQKASGEPVVVSGQITGLTEGEHGFHVHQYGDNTQGCTTAGPHFNPHSKKHGGPADEERHVGDLGNVAAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Target: Superoxide dismutase [Cu-Zn] (Sod1)