Anti-SARS-CoV-2 NSP9 Antibody, Rabbit, Polyclonal
Catalog Number:
BOB-A30395-CARRIER-FREE
| Article Name: |
Anti-SARS-CoV-2 NSP9 Antibody, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BOB-A30395-CARRIER-FREE |
| Supplier Catalog Number: |
A30395-carrier-free |
| Alternative Catalog Number: |
BOB-A30395-CARRIER-FREE-100UG,BOB-A30395-CARRIER-FREE-100UG/VIAL |
| Manufacturer: |
Boster Bio |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ELISA |
| Species Reactivity: |
Human |
| Immunogen: |
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
| Conjugation: |
Unconjugated |
| Alternative Names: |
Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp9, Non-structural protein 9 |
| Boster Bio Anti-SARS-CoV-2 NSP9 Antibody catalog A30395. Tested in ELISA applications. This antibody reacts with Human. |
| Clonality: |
Polyclonal |
| Concentration: |
Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
| Molecular Weight: |
Observed Molecular Weight: 140 kDa, 130 kDa, 110 kDa. Calculated Molecular Weight: 16693 MW |
| NCBI: |
43740578 |
| UniProt: |
P0DTC1 |
| Buffer: |
Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4. |
| Purity: |
Immunogen affinity purified. |
| Form: |
Lyophilized |
| Target: |
Synapsin-1 |
| Application Dilute: |
ELISA, 0.001-0.1µg/ml, Human |