Anti-SARS-CoV-2 NSP9 Antibody FITC Conjugated, Rabbit, Polyclonal

Catalog Number: BOB-A30395-FITC
Article Name: Anti-SARS-CoV-2 NSP9 Antibody FITC Conjugated, Rabbit, Polyclonal
Biozol Catalog Number: BOB-A30395-FITC
Supplier Catalog Number: A30395-FITC
Alternative Catalog Number: BOB-A30395-FITC-100UG,BOB-A30395-FITC-100UG/VIAL
Manufacturer: Boster Bio
Host: Rabbit
Category: Antikörper
Application: FC
Species Reactivity: Human
Immunogen: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Conjugation: FITC
Alternative Names: Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp9, Non-structural protein 9
Boster Bio Anti-SARS-CoV-2 NSP9 Antibody catalog A30395. Tested in ELISA applications. This antibody reacts with Human.
Clonality: Polyclonal
Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Molecular Weight: Calculated Molecular Weight: 16693 MW
NCBI: 43740578
UniProt: P0DTC1
Buffer: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Purity: Immunogen affinity purified.
Form: Liquid
Target: Synapsin-1
Application Dilute: Flow Cytometry, 1-3µg/1x106 cells