Anti-SARS-CoV-2 NSP9 Antibody HRP Conjugated, Rabbit, Polyclonal

Catalog Number: BOB-A30395-HRP
Article Name: Anti-SARS-CoV-2 NSP9 Antibody HRP Conjugated, Rabbit, Polyclonal
Biozol Catalog Number: BOB-A30395-HRP
Supplier Catalog Number: A30395-HRP
Alternative Catalog Number: BOB-A30395-HRP-100UG
Manufacturer: Boster Bio
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC, WB
Species Reactivity: Human
Immunogen: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Alternative Names: Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp10, Non-structural protein 10, Growth factor-like peptide, GFL, rep
Clonality: Polyclonal
Molecular Weight: Calculated Molecular Weight: 16693 MW
NCBI: 43740578
UniProt: P0DTC1
Buffer: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4.
Purity: Immunogen affinity purified.
Form: Liquid
Target: T-cell surface glycoprotein CD3 zeta chain
Application Dilute: Western blot, Optimal dilutions should be determined by end users. Immunohistochemistry (Paraffin-embedded Section), Optimal dilutions should be determined by end users. ELISA, Optimal dilutions should be determined by end users.