Anti-SARS-CoV-2 NSP3 Antibody, Rabbit, Polyclonal

Catalog Number: BOB-A33999-CARRIER-FREE
Article Name: Anti-SARS-CoV-2 NSP3 Antibody, Rabbit, Polyclonal
Biozol Catalog Number: BOB-A33999-CARRIER-FREE
Supplier Catalog Number: A33999-carrier-free
Alternative Catalog Number: BOB-A33999-CARRIER-FREE-100UG
Manufacturer: Boster Bio
Host: Rabbit
Category: Antikörper
Application: ELISA
Species Reactivity: Human
Immunogen: HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALK
Alternative Names: Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp10, Non-structural protein 10, Growth factor-like peptide, GFL, rep
Boster Bio Anti-SARS-CoV-2 NSP3 Antibody catalog A33999. Tested in ELISA applications. This antibody reacts with Human.
Clonality: Polyclonal
Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Molecular Weight: Observed Molecular Weight: 140 kDa, 130 kDa, 110 kDa. Calculated Molecular Weight: 16693 MW
NCBI: 43740578
UniProt: P0DTC1
Buffer: Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Purity: Immunogen affinity purified.
Form: Lyophilized
Target: P2X purinoceptor 1
Application Dilute: ELISA, 0.001-0.1µg/ml, Human