Mouse recombinant IL-27 EBI3 (Interleukin-27 EBI3) protein, AF

Catalog Number: BOB-PROTO35228-1-5UG
Article Name: Mouse recombinant IL-27 EBI3 (Interleukin-27 EBI3) protein, AF
Biozol Catalog Number: BOB-PROTO35228-1-5UG
Supplier Catalog Number: PROTO35228-1-5ug
Alternative Catalog Number: BOB-PROTO35228-1-5UG-5UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Mouse
Alternative Names: IL-27, Interleukin-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein, EBI3
Interleukin 27 EBI3 (IL-27 EBI3) predicts a molecular mass of 23.4 kDa. IL-27 is a heterodimeric cytokine that is encoded by Epstein-Barr virus-induced gene 3 (EBI3) and IL-27p28. It is expressed by antigen presenting cells and interacts with a specific cell-surface receptor complex known as IL-27 receptor (IL-27R).
Molecular Weight: The protein has a calculated MW of 23.84 kDa. The protein migrates about 25 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: O35228
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP with polyhistidine tag at the C-terminus.