Mouse recombinant RANKL (Receptor activator of nuclear factor kappa-beta ligand) protein, AF

Catalog Number: BOB-PROTO35235-4-5UG
Article Name: Mouse recombinant RANKL (Receptor activator of nuclear factor kappa-beta ligand) protein, AF
Biozol Catalog Number: BOB-PROTO35235-4-5UG
Supplier Catalog Number: PROTO35235-4-5ug
Alternative Catalog Number: BOB-PROTO35235-4-5UG-5UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Mouse
Alternative Names: soluble Receptor Activator of NF-kB Ligand, TNFSF11, TRANCE (TNF-Related Activation-induced Cytokine), OPGL, ODF (Osteoclast Differentiation Factor), CD254,sRNAK Ligand
Receptor activator of NF-kappaB (RANK) ligand (RANKL) is type II transmembrane protein with an extracellular domain at the carboxy terminus of TNF cytokine superfamily. RANKL is a 19.8 kDa protein containing 317 residues and high expressed in T cells and T cell rich organs, such as thymus and lymph nodes. RANKL-RANK (RANKL receptor) plays an important role in bone metabolism, dysregulation, and immune system. RANKL deficiencies in mice or humans are associated with abnormally increase bone density and blemish in lymphoid organogenesis.
Molecular Weight: The protein has a calculated MW of 20.35 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: O35235
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequence: MPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID with polyhistidine tag at the C-terminus.