Human recombinant IFN omega (interferon omega) protein, AF

Catalog Number: BOB-PROTP05000-3-500UG
Article Name: Human recombinant IFN omega (interferon omega) protein, AF
Biozol Catalog Number: BOB-PROTP05000-3-500UG
Supplier Catalog Number: PROTP05000-3-500ug
Alternative Catalog Number: BOB-PROTP05000-3-500UG-500UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: IFN alpha II-1, IFNW1
Interferon Omega (IFN-omega) is a 20.12 kDa member of type I IFN family with 173 amino acid residues. IL-28B is expressed by epithelial tissues. IFN-omega with antiviral, antitumor activity and regulating the innate immune response. Able to activate P13K/Akt signaling pathway via binding its receptor IFNAR in cells.
Molecular Weight: The protein has a calculated MW of 20.93 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P05000
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: MCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS with polyhistidine tag at the C-terminus.