Human recombinant IL-6 (Interleukin-6) protein, AF

Catalog Number: BOB-PROTP05231-8-20UG
Article Name: Human recombinant IL-6 (Interleukin-6) protein, AF
Biozol Catalog Number: BOB-PROTP05231-8-20UG
Supplier Catalog Number: PROTP05231-8-20ug
Alternative Catalog Number: BOB-PROTP05231-8-20UG-20UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: IFN-beta2, B-Cell Differentiation Factor (BCDF), BSF-2, HPGF, HSF, MGI-2
Interleukin-6 (IL-6) is a pleiotropic, 22-28 kDa cytokine which plays fundamental role in the acute phase response, inflammation, bone metabolism, lymphocyte differentiation and cancer progression. Deregulation of IL-6 production was also found in several diseases, including rheumatoid arthritis, Alzheimers disease, autoimmune deficiency disease and different types of cancer.
Molecular Weight: The protein has a calculated MW of 21.8 kDa. The protein migrates as 22 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P05231
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequence: MVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM with polyhistidine tag at the C-terminus.