Mouse recombinant TNF alpha (Tumor necrosis factor alpha) protein, AF

Catalog Number: BOB-PROTP06804-6-100UG
Article Name: Mouse recombinant TNF alpha (Tumor necrosis factor alpha) protein, AF
Biozol Catalog Number: BOB-PROTP06804-6-100UG
Supplier Catalog Number: PROTP06804-6-100ug
Alternative Catalog Number: BOB-PROTP06804-6-100UG-100UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Mouse
Alternative Names: TNFSF2, Cachectin, Differentiation-inducing factor (DIF), Necrosin, Cytotoxin, TNSF1A, TNF-a
Tumor necrosis factor alpha (TNF alpha) stimulates the acute phase of the immune response. In response to a pathogen, TNF alpha is one of the first to be released and can apply its effects in many organs. TNF alpha stimulates the release of corticotropic releasing hormone, suppresses appetite, and induces fever, in the hypothalamus. TNF increase vasodilation and loss of vascular permeability, it helps recruit lymphocyte, neutrophil, and monocyte to the inflammation site by regulating chemokine release.
Molecular Weight: The protein has a calculated MW of 18.2 kDa. The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P06804
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequence: MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYL DFAESGQVYFGVIAL with polyhistidine tag at the C-terminus.