Swine recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF

Catalog Number: BOB-PROTP07200-20UG
Article Name: Swine recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF
Biozol Catalog Number: BOB-PROTP07200-20UG
Supplier Catalog Number: PROTP07200-20ug
Alternative Catalog Number: BOB-PROTP07200-20UG-20UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Porcine
Alternative Names: TGF-BETA-1, TGFB1
Transforming Growth Factors beta 1 (TGF beta 1) is the cytokine of the TGF-beta family, which is a 12.5 kDa protein containing 113 amino acid residues. TGF beta 1 is produced by white blood cell which plays an important role in inflammation, cell proliferation and differentiation. TGF beta 1 also has several functions about cancer and auto-immune diseases. TGF-beta 1 not only can activate the smad signaling but also can induce the MAPK, Rhoa and RAS.
Molecular Weight: The protein has a calculated MW of 13.73 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P07200
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. If you have any concerns or special requirements, please confirm with us.
Sequence: MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus.