Human recombinant MMP2 (active) protein, AF

Catalog Number: BOB-PROTP08253-4-20UG
Article Name: Human recombinant MMP2 (active) protein, AF
Biozol Catalog Number: BOB-PROTP08253-4-20UG
Supplier Catalog Number: PROTP08253-4-20ug
Alternative Catalog Number: BOB-PROTP08253-4-20UG-20UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: Gelatinase A, TBE-1, MMP-II, MONA
Active matrix metalloproteinase-2 (Active MMP-2) is a 63 kDa matrix metalloproteinases with 558 amino acid residues. MMP-2 is mainly expressed from extracellular matrix organization. Functionally, it can degrade type IV collagen and involves processes of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture.
Molecular Weight: The protein has a calculated MW of 63.00 kDa. The protein migrates as 66 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P08253
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequence: MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESC