Mouse recombinant IL-1 beta (Interleukin-1 beta) protein, AF

Catalog Number: BOB-PROTP10749-5-20UG
Article Name: Mouse recombinant IL-1 beta (Interleukin-1 beta) protein, AF
Biozol Catalog Number: BOB-PROTP10749-5-20UG
Supplier Catalog Number: PROTP10749-5-20ug
Alternative Catalog Number: BOB-PROTP10749-5-20UG-20UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Mouse
Alternative Names: Catabolin, Lymphocyte-Activating Factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF)
Interleukin-1 beta (IL-1beta) is a major cytokine expressed in macrophage, NK cells, monocytes, and neutrophils. It also plays fundamental role in inflammatory response, including monocyte activation, which is essential for the host defense and pathogen and pathogen resistance. Pro-IL-1beta is cleaved by cytosolic caspase 1 to form mature IL-1beta.
Molecular Weight: The protein has a calculated MW of 18.3 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P10749
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS with polyhistidine tag at the C-terminus.