Mouse recombinant CXCL2 (C-X-C motif chemokine 2) protein, AF

Catalog Number: BOB-PROTP10889-2-20UG
Article Name: Mouse recombinant CXCL2 (C-X-C motif chemokine 2) protein, AF
Biozol Catalog Number: BOB-PROTP10889-2-20UG
Supplier Catalog Number: PROTP10889-2-20ug
Alternative Catalog Number: BOB-PROTP10889-2-20UG-20UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Mouse
Alternative Names: CINC, CINC-2a, GROb, Gr, Gro2, MIP, MIP-2, MIP-2a, Mgsa, Mgsa-b, Mi, Mip2, Scy, Scyb, Scyb2
C-X-C motif chemokine 2 (CXCL2) also named Growth-regulated oncogene beta (GRObeta), which is a chemokine of the intercrine alpha family. CXCL2 is a 8.1 kDa protein containing 73 amino acid residues. CXCL2 is often expressed in immune cells such as macrophages and monocytes. CXCL2 plays an important role with immune responses and cancer progression. CXCL2 activates the cell signal transduction with casepas1 that affects the cell proliferation, differentiation and migration.
Molecular Weight: The protein has a calculated MW of 8.66 kDa. The protein migrates below 11 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (N-term)
UniProt: P10889
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN with polyhistidine tag at the N-terminus.