Mouse recombinant CCL4 (C-C Motif Chemokine Ligand 4) protein, AF

Catalog Number: BOB-PROTP14097-2-20UG
Article Name: Mouse recombinant CCL4 (C-C Motif Chemokine Ligand 4) protein, AF
Biozol Catalog Number: BOB-PROTP14097-2-20UG
Supplier Catalog Number: PROTP14097-2-20ug
Alternative Catalog Number: BOB-PROTP14097-2-20UG-20UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Mouse
Alternative Names: MIP-1b: Macrophage Inflammatory Protein-1beta, ACT-2
C-C Motif Chemokine Ligand 4 (CCL4) is a 7.66 kDa cytokine with 69 amino acid residues. CCL4, also named macrophage inflammatory protein-1beta (MIP-1beta), is mainly secreted from neutrophils, monocytes, B cells, T cells, fibroblasts, endothelial cells, and epithelial cells. In addition, CCL4 participates in immune responses, including recruitment of immune cells like lymphocytes, monocytes, and leukocytes, response to IL-1 and IFNgamma, and production of TNF when CCL4 binds to CCR5.
Molecular Weight: The protein has a calculated MW of 8.64 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (N-term)
UniProt: P14097
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN with polyhistidine tag at the N-terminus.