Human recombinant MIF (Macrophage migration inhibitory factor) protein, AF

Catalog Number: BOB-PROTP14174-9-20UG
Article Name: Human recombinant MIF (Macrophage migration inhibitory factor) protein, AF
Biozol Catalog Number: BOB-PROTP14174-9-20UG
Supplier Catalog Number: PROTP14174-9-20ug
Alternative Catalog Number: BOB-PROTP14174-9-20UG-20UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: GLIF, mMIF, GIF, Glycosylation-inhibiting factor
Macrophage migration inhibitory factor (MIF) is a pleiotropic inflammatory mediator, predicts a molecular mass of 12.5 kDa. MIF binds to CD74, a type II transmembrane protein, inducing its phosphorylation and the recruitment of CD44, which then activates SRC family non-receptor tyrosine kinases, leading to ERK1 /2 phosphorylation.
Molecular Weight: The protein has a calculated MW of 13.28 kDa. The protein migrates as 10 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P14174
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequence: MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA with polyhistidine tag at the C-terminus.