Human recombinant LIF protein, AF

Catalog Number: BOB-PROTP15018-8-5UG
Article Name: Human recombinant LIF protein, AF
Biozol Catalog Number: BOB-PROTP15018-8-5UG
Supplier Catalog Number: PROTP15018-8-5ug
Alternative Catalog Number: BOB-PROTP15018-8-5UG-5UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: Differentiation-stimulating factor, D factor, Melanoma-derived LPL inhibitor (MLPLI), Interleukin 6 family cytokine
Leukemia inhibitory factor (LIF) is a pleiotropic glycoprotein, belonging to the IL-6 receptor family. LIF is a 19.7 kDa protein containing 202 amino acid which high expression in human liver, bone, uterus, kidney and the central nervous system. LIF is an inducer of differentiation in M1 leukemia cells, osteoblasts and glia. Not only stimulates proliferation of DA1 cells inhibits proliferation of corticotrophs and promote cell survival in some cell types but also induce apoptosis in others.
Molecular Weight: The protein has a calculated MW of 20.52 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (N-term)
UniProt: P15018
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF with polyhistidine tag at the N-terminus.