Mouse recombinant FGF-2 (Fibroblast growth factor-basic) protein, AF

Catalog Number: BOB-PROTP15655-2-500UG
Article Name: Mouse recombinant FGF-2 (Fibroblast growth factor-basic) protein, AF
Biozol Catalog Number: BOB-PROTP15655-2-500UG
Supplier Catalog Number: PROTP15655-2-500ug
Alternative Catalog Number: BOB-PROTP15655-2-500UG-500UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Mouse
Alternative Names: HBGF-2, Prostatropin
Basic fibroblast Growth Factors (FGF-2, bFGF), a pleiotropic cytokine, plays multiple roles in different cells and tissues. FGF-2 can stimulate smooth muscle cell growth, wound healing, and tissue repair. In addition, FGF-2 has been shown to regulate the generation of neurons and astrocytes from progenitor cells. FGF-2 are also involved in a variety of biological processes, including embryonic development, morphogenesis, tissue repair, tumor growth, and invasion. As a multifunctional cytokine, FGF-2 is first isolated from the pituitary. Later, it was identified from various cell types including cardiac myocytes, cardiac fibroblasts, endothelial cells, and smooth muscle cells.
Molecular Weight: The protein has a calculated MW of 17.2 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (N-term)
UniProt: P15655
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 0.01% sarkosyl in 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequence: ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS with polyhistidine tag at the N-terminus.