Human recombinant VEGF121 (Vascular endothelial growth factor 121) protein, AF

Catalog Number: BOB-PROTP15692-17-20UG
Article Name: Human recombinant VEGF121 (Vascular endothelial growth factor 121) protein, AF
Biozol Catalog Number: BOB-PROTP15692-17-20UG
Supplier Catalog Number: PROTP15692-17-20ug
Alternative Catalog Number: BOB-PROTP15692-17-20UG-20UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: VPF
Vascular Endothelial Growth Factors 121(VEGF121) is one of five VEGF splice variants of 121, 145, 165, 183, 189, and 206 amino acids (aa) in length. VEGF121 is the only VEGF which lacks heparin-binding activity and freely diffusible. VEGF binds the type I transmembrane receptor tyrosine kinases VEGF R1 (also called Flt-1) and VEGF R2 (Flk-1 /KDR) on endothelial cells to activate signal transduction and regulate both physiological and pathological angiogenesis.
Molecular Weight: The protein has a calculated MW of 15.00 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P15692
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequence: MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR with polyhistidine tag at the C-terminus.