Swine recombinant IFN gamma (Interferon gamma) protein, AF

Catalog Number: BOB-PROTP17803-5UG
Article Name: Swine recombinant IFN gamma (Interferon gamma) protein, AF
Biozol Catalog Number: BOB-PROTP17803-5UG
Supplier Catalog Number: PROTP17803-5ug
Alternative Catalog Number: BOB-PROTP17803-5UG-5UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Porcine
Alternative Names: IFNG
The cytokine IFN gamma could protect cells from viral infections and belongs to the family of interferons. A lot of studies have shown that IFN gamma secreted by antigen triggered cell types, including T cells, naive CD4+ T cells, macrophages, dendritic cells, and B cells. IFN gamma plays an important role to trigger the macrophage act against a diverse group of microbial targets, and the pleiotropic molecule associated with antiproliferative, pro-apoptotic and antitumor mechanisms. Based on the effector cytokine considered as a major effector of immunity, it has been used in the treatment of several diseases.
Molecular Weight: The protein has a calculated MW of 17.7 kDa. The protein migrates as 15 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P17803
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: MQAPFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKEESDKKIIQSQIVSFYFKFFEIFKDNQAIQRSMDVIKQDMFQRFLNGSSGKLNDFEKLIKIPVDNLQIQRKAISELIKVMNDLSPRSNLRKRKRSQTMFQGQRASK with polyhistidine tag at the C-terminus.