Galectin-3 (Gal-3) is one of the lectin family members, which is the only chimera?type galectin, containing one carbohydrate recognition domain (CRD) connected to a long, flexible N?terminal domain. The C?terminal CRD is responsible for beta-galactoside binding, and the N?terminal domain is essential for its multimerization, and interaction with other intracellular proteins. Galectin-3 is predominantly presented in the cytoplasm and expressed on the cell surface, and then often secreted into biological fluids, such as serum and urine. Numerous studies have indicated that galectin-3 plays a crucial role in cell proliferation, apoptosis, gene expression, immune surveillance, inflammation, fibrosis, and host defense.
Molecular Weight:
The protein has a calculated MW of 27 kDa. The protein migrates as 32 kDa under reducing condition (SDS-PAGE analysis).
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence:
ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI with
* VAT and and shipping costs not included. Errors and price changes excepted