Mouse recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF

Catalog Number: BOB-PROTP18340-1-20UG
Article Name: Mouse recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF
Biozol Catalog Number: BOB-PROTP18340-1-20UG
Supplier Catalog Number: PROTP18340-1-20ug
Alternative Catalog Number: BOB-PROTP18340-1-20UG-20UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Mouse
Alternative Names: Monokine Induced by Interferon-gamma, MIG
C-X-C motif chemokine 9 (CXCL9) also named monokine induced by gamma interferon (MIG), which is a chemokine of the intercrine alpha family. CXCL9 is a 11.7 kDa protein containing 10? amino acid residues. CXCL9 controls the immune cells by binding the CXCR3 which is including the cell migration and activation. During inflammation, CXCL9 is a chemotaxis for lymphocyte and macrophages. CXCL9 is participated in the process of tumor proliferation and metastasis.
Molecular Weight: The protein has a calculated MW of 13.00 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (N-term)
UniProt: P18340
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT with polyhistidine tag at the N-terminus.