Human recombinant CXCL2 (C-X-C motif chemokine 2) protein, AF

Catalog Number: BOB-PROTP19875-4-5UG
Article Name: Human recombinant CXCL2 (C-X-C motif chemokine 2) protein, AF
Biozol Catalog Number: BOB-PROTP19875-4-5UG
Supplier Catalog Number: PROTP19875-4-5ug
Alternative Catalog Number: BOB-PROTP19875-4-5UG-5UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: Growth Regulated Protein/Melanoma Growth Stimulatory Activity,GRO-beta: MGSAbeta,MIP-2alpha, GRO2
C-X-C motif chemokine 2 (CXCL2) also named Growth-regulated oncogene beta (GRObeta), which is a chemokine of the intercrine alpha family. CXCL2 is a 8 kDa protein containing 73 amino acid residues. CXCL2 is expressed in immune cells such as macrophages and monocytes. CXCL2 plays an important role with immune responses and cancer progression. CXCL2 activates the cell signal transduction with casepas1 that affect the cell proliferation, differentiation and migration.
Molecular Weight: The protein has a calculated MW of 8.70 kDa. The protein migrates as 12 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (N-term)
UniProt: P19875
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN with polyhistidine tag at the N-terminus.