Human recombinant CXCL3 (C-X-C motif chemokine 3) protein, AF

Product Overview

• Article Name: Human recombinant CXCL3 (C-X-C motif chemokine 3) protein, AF
• Biozol Catalog Number: BOB-PROTP19876-4-20UG
• Supplier Catalog Number: PROTP19876-4-20ug
• Alternative Catalog Number: BOB-PROTP19876-4-20UG-20UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Human
• Alternative Names: GRO-gamma: MGSAgamma, MIP-2beta, GRO3

Product Description

C-X-C motif chemokine 3 (CXCL3) also named Growth-regulated oncogene gamma (GROgamma), which is a chemokine of the intercrine alpha family. CXCL3 is a 8kDa protein containing 73 amino acid residues. During inflammation, CXCL3 is activated by the TNF and IL-1 which mediates the monocytes migration and adhesion by targeting the CXCR2. CXCL3 activates the JNK activity which induce the cell differentiation.

Product Properties

• Molecular Weight: The protein has a calculated MW of 8.67 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis).
• Tag: His Tag (N-term)
• UniProt: P19876
• Source: Escherichia coli
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
• Sequence: ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN with polyhistidine tag at the N-terminus.