Human recombinant SCF protein, AF

Catalog Number: BOB-PROTP21583-6-5UG
Article Name: Human recombinant SCF protein, AF
Biozol Catalog Number: BOB-PROTP21583-6-5UG
Supplier Catalog Number: PROTP21583-6-5ug
Alternative Catalog Number: BOB-PROTP21583-6-5UG-5UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: DCUA, DFNA69, FPH2, FPHH, KL-1, Kitl, MGF, SF, SHEP7, SLF, KIT ligand
Stem Cell Factor (SCF) is a 166-amino-acid protein with a monomeric molecular weight of approximately 18.5 kDa. SCF is the ligand for the tyrosine kinase receptor c-kit, which regulates other Growth Factorss, such as granulocyte colony-stimulating factor (G-CSF), granulocyte macrophage-colony-stimulating factor (GM-CSF), and interleukin-3 to stimulate proliferation, and differentiation of hematopoietic stem cells. SCF can be produced by a variety of cells, including fibroblasts, smooth muscle, endothelial cells, mast cells and bone marrow macrophages endothelial cells.
Molecular Weight: The protein has a calculated MW of 19.4 kDa. The protein migrates as 21 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P21583
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA with polyhistidine tag at the C-terminus